PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G061300.1
Common NamePOPTR_0002s06210g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 614aa    MW: 68967.7 Da    PI: 4.6173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G061300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.37.2e-54171432128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrFhPtdeelvv+yLk+k+ +k+l+l ++i+evd+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat++gyWkatgkd+
  Potri.002G061300.1  17 PPGFRFHPTDEELVVYYLKRKICKKRLKL-NIIREVDVYKWDPEELPgQsILKTGDRQWFFFSPRDRKYPNGARTNRATRQGYWKATGKDR 106
                         8****************************.89**************96446788999********************************** PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          v++ ++++vg+kktLvfy+grap+g +tdWvmhey+l
  Potri.002G061300.1 107 IVVC-NSRNVGVKKTLVFYRGRAPNGDRTDWVMHEYSL 143
                         ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6111166IPR003441NAC domain
PROSITE profilePS5100556.05616166IPR003441NAC domain
PfamPF023651.7E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MTVNADSCFG ADDKEWPPGF RFHPTDEELV VYYLKRKICK KRLKLNIIRE VDVYKWDPEE  60
LPGQSILKTG DRQWFFFSPR DRKYPNGART NRATRQGYWK ATGKDRIVVC NSRNVGVKKT  120
LVFYRGRAPN GDRTDWVMHE YSLDEEELKR CSNVQDYYAL YKVYKKSGAG PKNGEHYGAP  180
FKEEDWADDE FQCVNGMFTP DIPVKKHNEV TLVDNFIQSA QLEPPLNDFE EIIKQIGEEP  240
AHNELQNNDF TYLLPQVCVM VTGEEEAQST LVDPSFREFV CEPAGELTTS GQHCNKHTSF  300
NFDQSGTATL QLHEAPEVTS GTNYEQAPQL NEEDFLEIND LIDPEPSFSN TEQPVENLQF  360
DDFDGLSEFD LYHDAAMFLR DMGPVDQEAV SHSYMHPYGC DMVNQVGYQL QPDSIINAVD  420
YQLQQSNLVA NQVDCDLQPQ FFDAEQMNNQ LWVHGQRSNM LAASESHNGN LFQPTPGVVC  480
ESSNNSTRTN GNQGGKEGDA ADGWFSSALW GFVESIPTTP ASASENPLVN KAFERMSSFS  540
RIKMNVKSIN VDAASRIRMN VNSINVVAAN GAASVRSASR NKGFVLLSIV GVLCAILWVF  600
VGSGRLLGRS ISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-501714316140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13443KRKICKKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386290.10.0hypothetical protein POPTR_0002s06210g
TrEMBLU5GS920.0U5GS92_POPTR; Uncharacterized protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Representative plantOGRP9932711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-146NAC domain containing protein 17